SCOPe 2.04: Domain d3dgga2: 3dgg A:111-217

Lineage for d3dgga2 (3dgg A:111-217)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3dgga2: 3dgg A:111-217 [157715]
   Other proteins in same PDB: d3dgga1, d3dggb1, d3dggc1, d3dggd1
   automated match to d1tqbc2
   complexed with mg

Details for d3dgga2

PDB Entry: 3dgg, 2.3 Å

PDB Description: crystal structure of fabox108

PDB Compounds: (A:) FabOX108 Light Chain Fragment

SCOPe Domain Sequences for d3dgga2:

Sequence; same for both SEQRES and ATOM records:

>d3dgga2 b.1.1.2 (A:111-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3dgga2:

• d3dgga2 first appeared in SCOP 1.75
  
• d3dgga2 appears in SCOPe 2.03
  
• d3dgga2 appears in SCOPe 2.05
  
• d3dgga2 appears in the current release, SCOPe 2.08