Lineage for d3dgga1 (3dgg A:3-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783480Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 783509Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88537] (2 PDB entries)
  8. 783511Domain d3dgga1: 3dgg A:3-107 [157714]
    Other proteins in same PDB: d3dgga2, d3dggb1, d3dggc2, d3dggd1
    automatically matched to d1aqkl1
    complexed with mg

Details for d3dgga1

PDB Entry: 3dgg (more details), 2.3 Å

PDB Description: crystal structure of fabox108
PDB Compounds: (A:) FabOX108 Light Chain Fragment

SCOP Domain Sequences for d3dgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgga1 b.1.1.1 (A:3-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
vltqspaslavslgqratiscrasksvstsgysymhwyqqkpgqppklliylasnlesgv
parfsgsgsgtdftlnihpveeedaatyycqhsrelltfgagtkl

SCOP Domain Coordinates for d3dgga1:

Click to download the PDB-style file with coordinates for d3dgga1.
(The format of our PDB-style files is described here.)

Timeline for d3dgga1: