SCOPe 2.06: Domain d1i08b1: 1i08 B:1-90

Lineage for d1i08b1 (1i08 B:1-90)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)

8. Domain d1i08b1: 1i08 B:1-90 [15771]
   Other proteins in same PDB: d1i08a2, d1i08b2, d1i08c2, d1i08d2
   complexed with mn; mutant

Details for d1i08b1

PDB Entry: 1i08, 2.2 Å

PDB Description: crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli

PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1i08b1:

Sequence; same for both SEQRES and ATOM records:

>d1i08b1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkahqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

Timeline for d1i08b1:

• d1i08b1 first appeared (with stable ids) in SCOP 1.55
  
• d1i08b1 appears in SCOPe 2.05
  
• d1i08b1 appears in SCOPe 2.07
  
• d1i08b1 appears in the current release, SCOPe 2.08