Lineage for d3df4g1 (3df4 G:1-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219397Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1219398Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1219399Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1219400Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1219417Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 1219434Domain d3df4g1: 3df4 G:1-81 [157687]
    Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1
    automatically matched to 2AW4 G:1-81
    protein/RNA complex; complexed with mg, zn

Details for d3df4g1

PDB Entry: 3df4 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3df4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df4g1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOPe Domain Coordinates for d3df4g1:

Click to download the PDB-style file with coordinates for d3df4g1.
(The format of our PDB-style files is described here.)

Timeline for d3df4g1: