SCOP 1.75: Domain d3df3u1: 3df3 U:3-53

Lineage for d3df3u1 (3df3 U:3-53)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d3df3u1: 3df3 U:3-53 [157677]
   Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1
   automatically matched to 2AVY U:3-53
   complexed with hyg, mg

Details for d3df3u1

PDB Entry: 3df3, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOP Domain Sequences for d3df3u1:

Sequence; same for both SEQRES and ATOM records:

>d3df3u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d3df3u1:

• d3df3u1 is new in SCOP 1.75
  
• d3df3u1 appears in SCOPe 2.01
  
• d3df3u1 appears in the current release, SCOPe 2.08