Lineage for d3df3s1 (3df3 S:2-80)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200309Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1200310Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 1200311Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1200312Protein Ribosomal protein S19 [54572] (2 species)
  7. 1200313Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 1200321Domain d3df3s1: 3df3 S:2-80 [157675]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3t1, d3df3u1
    automatically matched to 2AVY S:2-80
    protein/RNA complex; complexed with hyg, mg

Details for d3df3s1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d3df3s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d3df3s1:

Click to download the PDB-style file with coordinates for d3df3s1.
(The format of our PDB-style files is described here.)

Timeline for d3df3s1: