Lineage for d3df3p1 (3df3 P:1-80)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200238Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1200239Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1200240Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1200241Protein Ribosomal protein S16 [54567] (3 species)
  7. 1200244Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1200252Domain d3df3p1: 3df3 P:1-80 [157672]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    automatically matched to 2AVY P:1-82
    protein/RNA complex; complexed with hyg, mg

Details for d3df3p1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d3df3p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3p1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnk

SCOPe Domain Coordinates for d3df3p1:

Click to download the PDB-style file with coordinates for d3df3p1.
(The format of our PDB-style files is described here.)

Timeline for d3df3p1: