![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [160143] (26 PDB entries) Uniprot P0A7T3 1-82 |
![]() | Domain d3df3p1: 3df3 P:1-80 [157672] Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1 automatically matched to 2AVY P:1-82 protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df3 (more details), 3.5 Å
SCOPe Domain Sequences for d3df3p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df3p1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw vgqgatisdrvaalikevnk
Timeline for d3df3p1: