Lineage for d3df3o1 (3df3 O:1-88)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764625Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 764626Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 764635Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 764636Protein Ribosomal protein S15 [47065] (3 species)
  7. 764639Species Escherichia coli [TaxId:562] [158383] (10 PDB entries)
    Uniprot Q8X9M2 2-89
  8. 764642Domain d3df3o1: 3df3 O:1-88 [157671]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    automatically matched to 2AVY O:1-88
    complexed with hyg, mg

Details for d3df3o1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d3df3o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3o1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr

SCOP Domain Coordinates for d3df3o1:

Click to download the PDB-style file with coordinates for d3df3o1.
(The format of our PDB-style files is described here.)

Timeline for d3df3o1: