Lineage for d3df3g1 (3df3 G:2-151)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495946Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1495947Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1495948Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1495949Protein Ribosomal protein S7 [47975] (4 species)
  7. 1495952Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
    Uniprot P02359 2-151
  8. 1495960Domain d3df3g1: 3df3 G:2-151 [157663]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    automatically matched to 2AVY G:2-151
    protein/RNA complex; complexed with hyg, mg

Details for d3df3g1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d3df3g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3g1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

SCOPe Domain Coordinates for d3df3g1:

Click to download the PDB-style file with coordinates for d3df3g1.
(The format of our PDB-style files is described here.)

Timeline for d3df3g1: