SCOPe 2.02: Domain d3df2i2: 3df2 I:1-72

Lineage for d3df2i2 (3df2 I:1-72)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d3df2i2: 3df2 I:1-72 [157638]
   Other proteins in same PDB: d3df201, d3df211, d3df231, d3df241, d3df2c1, d3df2c2, d3df2d1, d3df2e1, d3df2f1, d3df2g1, d3df2g2, d3df2h1, d3df2h2, d3df2i1, d3df2j1, d3df2k1, d3df2l1, d3df2m1, d3df2n1, d3df2o1, d3df2p1, d3df2q1, d3df2r1, d3df2s1, d3df2t1, d3df2u1, d3df2v1, d3df2w1, d3df2x1, d3df2y1, d3df2z1
   automatically matched to 2AW4 I:1-72
   protein/RNA complex; complexed with mg, zn

Details for d3df2i2

PDB Entry: 3df2, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3df2i2:

Sequence; same for both SEQRES and ATOM records:

>d3df2i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d3df2i2:

• d3df2i2 first appeared in SCOP 1.75
  
• d3df2i2 appears in SCOPe 2.01
  
• d3df2i2 appears in SCOPe 2.03
  
• d3df2i2 appears in the current release, SCOPe 2.08