SCOPe 2.07: Domain d3df2h2: 3df2 H:1-58

Lineage for d3df2h2 (3df2 H:1-58)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d3df2h2: 3df2 H:1-58 [157636]
   Other proteins in same PDB: d3df201, d3df211, d3df231, d3df241, d3df2c1, d3df2c2, d3df2d1, d3df2e1, d3df2f1, d3df2g1, d3df2g2, d3df2h1, d3df2i1, d3df2i2, d3df2j1, d3df2k1, d3df2l1, d3df2m1, d3df2n1, d3df2o1, d3df2p1, d3df2q1, d3df2r1, d3df2s1, d3df2t1, d3df2u1, d3df2v1, d3df2w1, d3df2x1, d3df2y1, d3df2z1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d3df2h2

PDB Entry: 3df2, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d3df2h2:

Sequence; same for both SEQRES and ATOM records:

>d3df2h2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d3df2h2:

• d3df2h2 first appeared in SCOP 1.75
  
• d3df2h2 appears in SCOPe 2.06
  
• d3df2h2 appears in the current release, SCOPe 2.08