SCOPe 2.07: Domain d3df2c2: 3df2 C:61-124

Lineage for d3df2c2 (3df2 C:61-124)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d3df2c2: 3df2 C:61-124 [157629]
   Other proteins in same PDB: d3df201, d3df211, d3df231, d3df241, d3df2c1, d3df2d1, d3df2e1, d3df2f1, d3df2g1, d3df2g2, d3df2h1, d3df2h2, d3df2i1, d3df2i2, d3df2j1, d3df2k1, d3df2l1, d3df2m1, d3df2n1, d3df2o1, d3df2p1, d3df2q1, d3df2r1, d3df2s1, d3df2t1, d3df2u1, d3df2v1, d3df2w1, d3df2x1, d3df2y1, d3df2z1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d3df2c2

PDB Entry: 3df2, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d3df2c2:

Sequence; same for both SEQRES and ATOM records:

>d3df2c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d3df2c2:

• d3df2c2 first appeared in SCOP 1.75
  
• d3df2c2 appears in SCOPe 2.06
  
• d3df2c2 appears in the current release, SCOPe 2.08