Lineage for d3df1u1 (3df1 U:3-53)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1472388Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1472389Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1472390Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1472391Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1472392Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1472399Domain d3df1u1: 3df1 U:3-53 [157623]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1
    automatically matched to 2AVY U:3-53
    protein/RNA complex; complexed with hyg, mg

Details for d3df1u1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d3df1u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d3df1u1:

Click to download the PDB-style file with coordinates for d3df1u1.
(The format of our PDB-style files is described here.)

Timeline for d3df1u1: