| Class j: Peptides [58231] (121 folds) |
| Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) ![]() |
| Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
| Protein Ribosomal protein S21, RpsU [161310] (1 species) |
| Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
| Domain d3df1u1: 3df1 U:3-53 [157623] Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1 automatically matched to 2AVY U:3-53 complexed with hyg, mg |
PDB Entry: 3df1 (more details), 3.5 Å
SCOP Domain Sequences for d3df1u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df1u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d3df1u1: