Class a: All alpha proteins [46456] (285 folds) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
Protein Ribosomal protein S15 [47065] (3 species) |
Species Escherichia coli [TaxId:562] [158383] (10 PDB entries) Uniprot Q8X9M2 2-89 |
Domain d3df1o1: 3df1 O:1-88 [157617] Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1 automatically matched to 2AVY O:1-88 protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df1 (more details), 3.5 Å
SCOPe Domain Sequences for d3df1o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df1o1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]} slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs qrrklldylkrkdvarytrlierlglrr
Timeline for d3df1o1: