Lineage for d3df1o1 (3df1 O:1-88)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764625Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 764626Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 764635Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 764636Protein Ribosomal protein S15 [47065] (3 species)
  7. 764639Species Escherichia coli [TaxId:562] [158383] (10 PDB entries)
    Uniprot Q8X9M2 2-89
  8. 764641Domain d3df1o1: 3df1 O:1-88 [157617]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    automatically matched to 2AVY O:1-88
    complexed with hyg, mg

Details for d3df1o1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d3df1o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1o1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr

SCOP Domain Coordinates for d3df1o1:

Click to download the PDB-style file with coordinates for d3df1o1.
(The format of our PDB-style files is described here.)

Timeline for d3df1o1: