Lineage for d3df1k1 (3df1 K:12-128)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837368Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 837458Protein Ribosomal protein S11 [53141] (2 species)
  7. 837459Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 837465Domain d3df1k1: 3df1 K:12-128 [157613]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    automatically matched to 2AVY K:12-128
    complexed with hyg, mg

Details for d3df1k1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d3df1k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1k1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOP Domain Coordinates for d3df1k1:

Click to download the PDB-style file with coordinates for d3df1k1.
(The format of our PDB-style files is described here.)

Timeline for d3df1k1: