Lineage for d3df1i1 (3df1 I:3-129)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537343Protein Ribosomal protein S9 [54218] (2 species)
  7. 2537344Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. 2537352Domain d3df1i1: 3df1 I:3-129 [157611]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df1i1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d3df1i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1i1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
rpqfskr

SCOPe Domain Coordinates for d3df1i1:

Click to download the PDB-style file with coordinates for d3df1i1.
(The format of our PDB-style files is described here.)

Timeline for d3df1i1: