Lineage for d3df1h1 (3df1 H:2-128)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647137Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2647152Domain d3df1h1: 3df1 H:2-128 [157610]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df1h1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d3df1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1h1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d3df1h1:

Click to download the PDB-style file with coordinates for d3df1h1.
(The format of our PDB-style files is described here.)

Timeline for d3df1h1: