Lineage for d3df1e2 (3df1 E:9-77)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025346Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1025347Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1025422Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 1025423Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 1025426Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
    Uniprot P0A7W1 9-77
  8. 1025433Domain d3df1e2: 3df1 E:9-77 [157607]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    automatically matched to 2AVY E:9-77
    protein/RNA complex; complexed with hyg, mg

Details for d3df1e2

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d3df1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1e2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

SCOPe Domain Coordinates for d3df1e2:

Click to download the PDB-style file with coordinates for d3df1e2.
(The format of our PDB-style files is described here.)

Timeline for d3df1e2: