Lineage for d3df1c2 (3df1 C:106-206)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860387Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 860388Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 860389Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 860390Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 860391Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. 860397Domain d3df1c2: 3df1 C:106-206 [157604]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    automatically matched to 2AVY C:106-206
    complexed with hyg, mg

Details for d3df1c2

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d3df1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOP Domain Coordinates for d3df1c2:

Click to download the PDB-style file with coordinates for d3df1c2.
(The format of our PDB-style files is described here.)

Timeline for d3df1c2: