SCOP 1.57: Domain d1msda1: 1msd A:1-83

Lineage for d1msda1 (1msd A:1-83)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (8 PDB entries)

8. Domain d1msda1: 1msd A:1-83 [15758]
   Other proteins in same PDB: d1msda2, d1msdb2

Details for d1msda1

PDB Entry: 1msd, 3.2 Å

PDB Description: comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from thermus thermophilus. differences in dimer-dimer interactions.

SCOP Domain Sequences for d1msda1:

Sequence; same for both SEQRES and ATOM records:

>d1msda1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1msda1:

• d1msda1 first appeared (with stable ids) in SCOP 1.55
  
• d1msda1 appears in SCOP 1.59
  
• d1msda1 appears in the current release, SCOPe 2.08