![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
![]() | Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
![]() | Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
![]() | Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160201] (29 PDB entries) Uniprot P0A7J7 1-72 |
![]() | Domain d3degh2: 3deg H:1-72 [157575] Other proteins in same PDB: d3degd1, d3degh1 automatically matched to 2AW4 I:1-72 complexed with 1ma, 2mg, 5mc, 5mu, 7mg, h2u, m2g, omc, omg, psu, yg |
PDB Entry: 3deg (more details)
SCOP Domain Sequences for d3degh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3degh2 d.47.1.1 (H:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv yadrsftfvtkt
Timeline for d3degh2: