Lineage for d3degh1 (3deg H:73-141)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480444Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1480445Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1480446Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1480464Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 1480489Domain d3degh1: 3deg H:73-141 [157574]
    Other proteins in same PDB: d3degd1, d3degh2
    automatically matched to 2AW4 I:73-141
    protein/RNA complex

Details for d3degh1

PDB Entry: 3deg (more details), 10.9 Å

PDB Description: complex of elongating escherichia coli 70s ribosome and ef4(lepa)- gmppnp
PDB Compounds: (H:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3degh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3degh1 a.4.7.1 (H:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d3degh1:

Click to download the PDB-style file with coordinates for d3degh1.
(The format of our PDB-style files is described here.)

Timeline for d3degh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3degh2
View in 3D
Domains from other chains:
(mouse over for more information)
d3degd1