SCOP 1.75: Domain d3degh1: 3deg H:73-141

Lineage for d3degh1 (3deg H:73-141)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
   Uniprot P0A7J7 73-141

8. Domain d3degh1: 3deg H:73-141 [157574]
   Other proteins in same PDB: d3degd1, d3degh2
   automatically matched to 2AW4 I:73-141
   complexed with 1ma, 2mg, 5mc, 5mu, 7mg, h2u, m2g, omc, omg, psu, yg

Details for d3degh1

PDB Entry: 3deg

PDB Description: complex of elongating escherichia coli 70s ribosome and ef4(lepa)- gmppnp

PDB Compounds: (H:) 50S ribosomal protein L11

SCOP Domain Sequences for d3degh1:

Sequence; same for both SEQRES and ATOM records:

>d3degh1 a.4.7.1 (H:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

Timeline for d3degh1:

• d3degh1 is new in SCOP 1.75
  
• d3degh1 appears in SCOPe 2.01
  
• d3degh1 appears in the current release, SCOPe 2.08