Lineage for d3degd1 (3deg D:1-123)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799967Protein Ribosomal protein S12 [50302] (2 species)
  7. 799968Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 799993Domain d3degd1: 3deg D:1-123 [157573]
    Other proteins in same PDB: d3degh1, d3degh2
    automatically matched to 2AVY L:1-123
    complexed with 1ma, 2mg, 5mc, 5mu, 7mg, h2u, m2g, omc, omg, psu, yg

Details for d3degd1

PDB Entry: 3deg (more details)

PDB Description: complex of elongating escherichia coli 70s ribosome and ef4(lepa)- gmppnp
PDB Compounds: (D:) 30S ribosomal protein S12

SCOP Domain Sequences for d3degd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3degd1 b.40.4.5 (D:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOP Domain Coordinates for d3degd1:

Click to download the PDB-style file with coordinates for d3degd1.
(The format of our PDB-style files is described here.)

Timeline for d3degd1: