Lineage for d3degd1 (3deg D:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789950Protein Ribosomal protein S12 [50302] (2 species)
  7. 2789951Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 2789976Domain d3degd1: 3deg D:1-123 [157573]
    Other proteins in same PDB: d3degh1, d3degh2
    automatically matched to 2AVY L:1-123
    protein/RNA complex

Details for d3degd1

PDB Entry: 3deg (more details), 10.9 Å

PDB Description: complex of elongating escherichia coli 70s ribosome and ef4(lepa)- gmppnp
PDB Compounds: (D:) 30S ribosomal protein S12

SCOPe Domain Sequences for d3degd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3degd1 b.40.4.5 (D:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOPe Domain Coordinates for d3degd1:

Click to download the PDB-style file with coordinates for d3degd1.
(The format of our PDB-style files is described here.)

Timeline for d3degd1: