SCOPe 2.01: Domain d3dedb1: 3ded B:341-426

Lineage for d3dedb1 (3ded B:341-426)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Probable hemolysin CV0231 [160841] (1 species)

7. Species Chromobacterium violaceum [TaxId:536] [160842] (1 PDB entry)
   Uniprot Q7P1I2 341-427

8. Domain d3dedb1: 3ded B:341-426 [157568]
   automatically matched to 3DED A:341-427
   complexed with ca

Details for d3dedb1

PDB Entry: 3ded, 2.14 Å

PDB Description: c-terminal domain of probable hemolysin from chromobacterium violaceum

PDB Compounds: (B:) Probable hemolysin

SCOPe Domain Sequences for d3dedb1:

Sequence; same for both SEQRES and ATOM records:

>d3dedb1 d.145.1.4 (B:341-426) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]}
deivqredgswlvdgmvsldrfreffeleaplpgeaggnihtlagvmlyqlgrvpsvtdr
fewngfsfevvdmdrtrvdkilvqrh

Timeline for d3dedb1:

• d3dedb1 first appeared in SCOP 1.75
  
• d3dedb1 appears in SCOPe 2.02
  
• d3dedb1 appears in the current release, SCOPe 2.08, called d3dedb_