Class a: All alpha proteins [46456] (286 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries) |
Domain d3ddpd1: 3ddp D:171-309 [157557] Other proteins in same PDB: d3ddpa_, d3ddpc_ automated match to d1finb1 complexed with rc8 |
PDB Entry: 3ddp (more details), 2.7 Å
SCOPe Domain Sequences for d3ddpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ddpd1 a.74.1.1 (D:171-309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq vlrmehlvlkvlafdlaap
Timeline for d3ddpd1:
View in 3D Domains from other chains: (mouse over for more information) d3ddpa_, d3ddpb1, d3ddpb2, d3ddpc_ |