| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (9 PDB entries) |
| Domain d3dcgd_: 3dcg D: [157537] Other proteins in same PDB: d3dcga_, d3dcgc_ automated match to d1lm8c_ protein/RNA complex |
PDB Entry: 3dcg (more details), 2.4 Å
SCOPe Domain Sequences for d3dcgd_:
Sequence, based on SEQRES records: (download)
>d3dcgd_ d.42.1.1 (D:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d3dcgd_ d.42.1.1 (D:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc
Timeline for d3dcgd_: