Lineage for d1abmb1 (1abm B:1-83)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149219Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 149315Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 149316Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 149392Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 149432Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries)
  8. 149438Domain d1abmb1: 1abm B:1-83 [15749]
    Other proteins in same PDB: d1abma2, d1abmb2

Details for d1abmb1

PDB Entry: 1abm (more details), 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles

SCOP Domain Sequences for d1abmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abmb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1abmb1:

Click to download the PDB-style file with coordinates for d1abmb1.
(The format of our PDB-style files is described here.)

Timeline for d1abmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abmb2