Lineage for d3dbld1 (3dbl D:12-441)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848423Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 848424Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 848431Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 848459Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 848460Species Human (Homo sapiens) [TaxId:9606] [89765] (7 PDB entries)
    Uniprot Q8TBC4 33-458
  8. 848472Domain d3dbld1: 3dbl D:12-441 [157476]
    Other proteins in same PDB: d3dbla1, d3dblc1, d3dble1, d3dblg1, d3dbli1
    automatically matched to d1r4mb_
    complexed with zn; mutant

Details for d3dbld1

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (D:) NEDD8-activating enzyme E1 catalytic subunit

SCOP Domain Sequences for d3dbld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbld1 c.111.1.2 (D:12-441) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhft

SCOP Domain Coordinates for d3dbld1:

Click to download the PDB-style file with coordinates for d3dbld1.
(The format of our PDB-style files is described here.)

Timeline for d3dbld1: