Lineage for d3dbhi_ (3dbh I:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402240Protein Nedd8 [54244] (1 species)
  7. 1402241Species Human (Homo sapiens) [TaxId:9606] [54245] (10 PDB entries)
    Uniprot Q15843
  8. 1402250Domain d3dbhi_: 3dbh I: [157472]
    Other proteins in same PDB: d3dbha_, d3dbhb_, d3dbhc_, d3dbhd_, d3dbhe_, d3dbhf_, d3dbhg_, d3dbhh_
    automated match to d1nddb_
    complexed with zn

Details for d3dbhi_

PDB Entry: 3dbh (more details), 2.85 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)
PDB Compounds: (I:) nedd8

SCOPe Domain Sequences for d3dbhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbhi_ d.15.1.1 (I:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
rrasvgsggsmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqm
ndektaadykilggsvlhlvlrlrgg

SCOPe Domain Coordinates for d3dbhi_:

Click to download the PDB-style file with coordinates for d3dbhi_.
(The format of our PDB-style files is described here.)

Timeline for d3dbhi_: