SCOPe 2.07: Domain d1ap6b1: 1ap6 B:1-83

Lineage for d1ap6b1 (1ap6 B:1-83)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries)

8. Domain d1ap6b1: 1ap6 B:1-83 [15747]
   Other proteins in same PDB: d1ap6a2, d1ap6b2
   complexed with mn; mutant

Details for d1ap6b1

PDB Entry: 1ap6, 1.9 Å

PDB Description: tyr34->phe mutant of human mitochondrial manganese superoxide dismutase

PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1ap6b1:

Sequence; same for both SEQRES and ATOM records:

>d1ap6b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1ap6b1:

• d1ap6b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ap6b1 appears in SCOPe 2.06
  
• d1ap6b1 appears in the current release, SCOPe 2.08