Lineage for d3d8ah1 (3d8a H:60-122)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780803Fold a.241: TraM-like [140580] (1 superfamily)
    multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices
  4. 780804Superfamily a.241.1: TraM-like [140581] (1 family) (S)
  5. 780805Family a.241.1.1: TraM-like [140582] (1 protein)
    Pfam PF05261
  6. 780806Protein TraM [140583] (2 species)
    also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566))
    also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566))
  7. 780807Species Escherichia coli K12 (Escherichia coli K-12) [TaxId:83333] [158509] (1 PDB entry)
  8. 780815Domain d3d8ah1: 3d8a H:60-122 [157455]
    automatically matched to d2g7oa1

Details for d3d8ah1

PDB Entry: 3d8a (more details), 2.55 Å

PDB Description: co-crystal structure of tram-trad complex.
PDB Compounds: (H:) Protein traM

SCOP Domain Sequences for d3d8ah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d8ah1 a.241.1.1 (H:60-122) TraM {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]}
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffp

SCOP Domain Coordinates for d3d8ah1:

Click to download the PDB-style file with coordinates for d3d8ah1.
(The format of our PDB-style files is described here.)

Timeline for d3d8ah1: