SCOPe 2.01: Domain d3d8af_: 3d8a F:

Lineage for d3d8af_ (3d8a F:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.241: TraM-like [140580] (1 superfamily)
   multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices

4. Superfamily a.241.1: TraM-like [140581] (1 family)

5. Family a.241.1.1: TraM-like [140582] (1 protein)
   Pfam PF05261

6. Protein TraM [140583] (2 species)
   also includes the N-terminal domain structure 1dp3, previously classified into a different family (63566)

7. Species Escherichia coli K-12 [TaxId:83333] [158509] (1 PDB entry)

8. Domain d3d8af_: 3d8a F: [157453]
   automated match to d2g7oa1
   protein/DNA complex

Details for d3d8af_

PDB Entry: 3d8a, 2.55 Å

PDB Description: co-crystal structure of tram-trad complex.

PDB Compounds: (F:) Protein traM

SCOPe Domain Sequences for d3d8af_:

Sequence; same for both SEQRES and ATOM records:

>d3d8af_ a.241.1.1 (F:) TraM {Escherichia coli K-12 [TaxId: 83333]}
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffp

Timeline for d3d8af_:

• d3d8af_ first appeared in SCOP 1.75, called d3d8af1
  
• d3d8af_ appears in SCOPe 2.02
  
• d3d8af_ appears in the current release, SCOPe 2.08