SCOPe 2.08: Domain d3d87b3: 3d87 B:212-305

Lineage for d3d87b3 (3d87 B:212-305)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)

8. Domain d3d87b3: 3d87 B:212-305 [157444]
   Other proteins in same PDB: d3d87b1, d3d87d1
   automatically matched to d1f42a3
   complexed with k, man, po4

Details for d3d87b3

PDB Entry: 3d87, 2.9 Å

PDB Description: crystal structure of interleukin-23

PDB Compounds: (B:) Interleukin-12 subunit p40

SCOPe Domain Sequences for d3d87b3:

Sequence, based on SEQRES records:

>d3d87b3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpc

Sequence, based on observed residues (ATOM records):

>d3d87b3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqdrvftdktsatvicr
knasisvraqdryyssswsewasvpc

Timeline for d3d87b3:

• d3d87b3 first appeared in SCOP 1.75
  
• d3d87b3 appears in SCOPe 2.07