SCOPe 2.04: Domain d3d87b2: 3d87 B:88-211

Lineage for d3d87b2 (3d87 B:88-211)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)

8. Domain d3d87b2: 3d87 B:88-211 [157443]
   Other proteins in same PDB: d3d87b1, d3d87d1
   automatically matched to d1f42a2
   complexed with k, man, po4

Details for d3d87b2

PDB Entry: 3d87, 2.9 Å

PDB Description: crystal structure of interleukin-23

PDB Compounds: (B:) Interleukin-12 subunit p40

SCOPe Domain Sequences for d3d87b2:

Sequence; same for both SEQRES and ATOM records:

>d3d87b2 b.1.2.1 (B:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyeqytssffi
rdii

Timeline for d3d87b2:

• d3d87b2 first appeared in SCOP 1.75
  
• d3d87b2 appears in SCOPe 2.03
  
• d3d87b2 appears in SCOPe 2.05
  
• d3d87b2 appears in the current release, SCOPe 2.08