Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries) |
Domain d3d85d3: 3d85 D:212-305 [157441] Other proteins in same PDB: d3d85a1, d3d85a2, d3d85d1 automatically matched to d1f42a3 complexed with imd, mpd |
PDB Entry: 3d85 (more details), 1.9 Å
SCOPe Domain Sequences for d3d85d3:
Sequence, based on SEQRES records: (download)
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk tsatvicrknasisvraqdryyssswsewasvpc
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} kpdppknlqlkplqvevsweypdtwstphsyfsltfcvqvqgkdrvftdktsatvicrkn asisvraqdryyssswsewasvpc
Timeline for d3d85d3: