Lineage for d3d7uc1 (3d7u C:188-448)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1042480Protein Carboxyl-terminal src kinase (csk) [56164] (1 species)
    PTK group; CSK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1042481Species Human (Homo sapiens) [TaxId:9606] [56165] (3 PDB entries)
  8. 1042490Domain d3d7uc1: 3d7u C:188-448 [157433]
    automatically matched to d1byga_

Details for d3d7uc1

PDB Entry: 3d7u (more details), 4.11 Å

PDB Description: Structural basis for the recognition of c-Src by its inactivator Csk
PDB Compounds: (C:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d3d7uc1:

Sequence, based on SEQRES records: (download)

>d3d7uc1 d.144.1.7 (C:188-448) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
nnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealrekkfstks
dvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhlda
amrpsflqlreqlehikthel

Sequence, based on observed residues (ATOM records): (download)

>d3d7uc1 d.144.1.7 (C:188-448) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
nnfvhrdlaarnvlvsednvakvsdfgltkeasklpvkwtapealrekkfstksdvwsfg
illweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsf
lqlreqlehikthel

SCOPe Domain Coordinates for d3d7uc1:

Click to download the PDB-style file with coordinates for d3d7uc1.
(The format of our PDB-style files is described here.)

Timeline for d3d7uc1: