Lineage for d3d7sc1 (3d7s C:1-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906435Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2906443Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 2906666Domain d3d7sc1: 3d7s C:1-150 [157428]
    Other proteins in same PDB: d3d7sb1, d3d7sb2, d3d7sd1, d3d7sd2
    automated match to d3csua1
    complexed with zn

Details for d3d7sc1

PDB Entry: 3d7s (more details), 2.8 Å

PDB Description: Crystal structure of Wild-Type E. Coli Asparate Transcarbamoylase at pH 8.5 at 2.80 A Resolution
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d3d7sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d7sc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d3d7sc1:

Click to download the PDB-style file with coordinates for d3d7sc1.
(The format of our PDB-style files is described here.)

Timeline for d3d7sc1: