Lineage for d3d5sc1 (3d5s C:11-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986245Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
    automatically mapped to Pfam PF12199
  5. 1986246Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
    this is a repeat family; one repeat unit is 2gom A:105-165 found in domain
  6. 1986247Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)
  7. 1986248Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
    Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165
  8. 1986255Domain d3d5sc1: 3d5s C:11-75 [157409]
    Other proteins in same PDB: d3d5sa2, d3d5sa3, d3d5sb2, d3d5sb3

Details for d3d5sc1

PDB Entry: 3d5s (more details), 2.3 Å

PDB Description: crystal structure of efb-c (r131a) / c3d complex
PDB Compounds: (C:) Fibrinogen-binding protein

SCOPe Domain Sequences for d3d5sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5sc1 a.7.17.1 (C:11-75) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
tdatikkeqkliqaqnlvrefekthtvsahakaqkavnlvsfeykvkkmvlqeridnvlk
qglvr

SCOPe Domain Coordinates for d3d5sc1:

Click to download the PDB-style file with coordinates for d3d5sc1.
(The format of our PDB-style files is described here.)

Timeline for d3d5sc1: