Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.17: Efb C-domain-like [158366] (1 family) automatically mapped to Pfam PF12199 |
Family a.7.17.1: Efb C-domain-like [158367] (2 proteins) PfamB PB008033 this is a repeat family; one repeat unit is 2gom A:105-165 found in domain |
Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries) Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165 |
Domain d3d5sc1: 3d5s C:11-75 [157409] Other proteins in same PDB: d3d5sa2, d3d5sa3, d3d5sb2, d3d5sb3 |
PDB Entry: 3d5s (more details), 2.3 Å
SCOPe Domain Sequences for d3d5sc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5sc1 a.7.17.1 (C:11-75) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]} tdatikkeqkliqaqnlvrefekthtvsahakaqkavnlvsfeykvkkmvlqeridnvlk qglvr
Timeline for d3d5sc1: