Lineage for d3d5rb_ (3d5r B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920721Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 920975Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 921000Protein automated matches [190371] (1 species)
    not a true protein
  7. 921001Species Human (Homo sapiens) [TaxId:9606] [187209] (3 PDB entries)
  8. 921006Domain d3d5rb_: 3d5r B: [157404]
    Other proteins in same PDB: d3d5rc1, d3d5rd_
    automated match to d1c3da_

Details for d3d5rb_

PDB Entry: 3d5r (more details), 2.1 Å

PDB Description: crystal structure of efb-c (n138a) / c3d complex
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d3d5rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5rb_ a.102.4.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsrstdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelik
kgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlile
kqkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsit
kagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynv
eatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d3d5rb_:

Click to download the PDB-style file with coordinates for d3d5rb_.
(The format of our PDB-style files is described here.)

Timeline for d3d5rb_: