Lineage for d3d5du1 (3d5d U:2-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017239Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2017277Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2017278Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2017279Protein Ribosomal protein L20 [74733] (4 species)
  7. 2017319Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 2017323Domain d3d5du1: 3d5d U:2-118 [157393]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5dv1, d3d5dy1, d3d5dz1
    complexed with mg
    complexed with mg

Details for d3d5du1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (U:) 50S ribosomal protein L20

SCOPe Domain Sequences for d3d5du1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5du1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOPe Domain Coordinates for d3d5du1:

Click to download the PDB-style file with coordinates for d3d5du1.
(The format of our PDB-style files is described here.)

Timeline for d3d5du1: