Lineage for d3d5du1 (3d5d U:2-118)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778923Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 778938Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
  5. 778939Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 778940Protein Ribosomal protein L20 [74733] (4 species)
  7. 778984Species Thermus thermophilus [TaxId:274] [158510] (11 PDB entries)
    Uniprot P60491 1-117
  8. 778988Domain d3d5du1: 3d5d U:2-118 [157393]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5dv1, d3d5dy1, d3d5dz1
    automatically matched to 2J01 U:2-118
    complexed with mg

Details for d3d5du1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (U:) 50S ribosomal protein L20

SCOP Domain Sequences for d3d5du1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5du1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOP Domain Coordinates for d3d5du1:

Click to download the PDB-style file with coordinates for d3d5du1.
(The format of our PDB-style files is described here.)

Timeline for d3d5du1: