Lineage for d3d5de1 (3d5d E:1-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793163Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2793164Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2793264Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries)
    Uniprot Q72I04 1-205
  8. 2793268Domain d3d5de1: 3d5d E:1-204 [157387]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
    complexed with mg
    complexed with mg

Details for d3d5de1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (E:) 50S ribosomal protein L3

SCOPe Domain Sequences for d3d5de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5de1 b.43.3.2 (E:1-204) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]}
mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
lllvkgavpgpngglvivretkka

SCOPe Domain Coordinates for d3d5de1:

Click to download the PDB-style file with coordinates for d3d5de1.
(The format of our PDB-style files is described here.)

Timeline for d3d5de1: