![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
![]() | Protein Ribosomal protein S9 [54218] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
![]() | Domain d3d5ci1: 3d5c I:2-128 [157373] Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 3d5c (more details), 3.21 Å
SCOPe Domain Sequences for d3d5ci1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5ci1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d3d5ci1: