Lineage for d3d5cg1 (3d5c G:2-156)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274376Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1274377Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1274378Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1274379Protein Ribosomal protein S7 [47975] (4 species)
  7. 1274409Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1274433Domain d3d5cg1: 3d5c G:2-156 [157371]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1
    automatically matched to d1fjgg_
    complexed with mg, zn

Details for d3d5cg1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d3d5cg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5cg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d3d5cg1:

Click to download the PDB-style file with coordinates for d3d5cg1.
(The format of our PDB-style files is described here.)

Timeline for d3d5cg1: