Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein) Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members |
Protein Ribosomal protein L33p [144204] (3 species) |
Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries) Uniprot P35871 8-52 |
Domain d3d5b61: 3d5b 6:9-52 [157355] Other proteins in same PDB: d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1 automatically matched to 2J01 6:9-53 complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5b61:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5b61 g.41.8.6 (6:9-52) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]} lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrev
Timeline for d3d5b61: