![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
![]() | Domain d3d5at1: 3d5a T:8-106 [157353] Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5au1 automatically matched to d1fjgt_ complexed with mg, zn |
PDB Entry: 3d5a (more details), 3.21 Å
SCOP Domain Sequences for d3d5at1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5at1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d3d5at1: